Protein Info for MPMX20_03570 in Enterobacter sp. TBS_079

Annotation: Fructose-1-phosphate phosphatase YqaB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 188 PF00702: Hydrolase" amino acids 5 to 179 (175 residues), 93.6 bits, see alignment E=2.2e-30 TIGR02009: beta-phosphoglucomutase family hydrolase" amino acids 5 to 185 (181 residues), 201.3 bits, see alignment E=2.4e-63 PF13419: HAD_2" amino acids 8 to 183 (176 residues), 94.8 bits, see alignment E=6.9e-31 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 121 to 183 (63 residues), 48.7 bits, see alignment E=1.4e-16

Best Hits

Swiss-Prot: 79% identical to YQAB_ECOLI: Fructose-1-phosphate phosphatase YqaB (yqaB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to enc:ECL_04029)

MetaCyc: 79% identical to fructose-1-phosphate phosphatase YqaB (Escherichia coli K-12 substr. MG1655)
3.1.3.-

Predicted SEED Role

"Putative phosphatase YqaB" in subsystem 2-phosphoglycolate salvage

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (188 amino acids)

>MPMX20_03570 Fructose-1-phosphate phosphatase YqaB (Enterobacter sp. TBS_079)
MYAQYDGLIFDMDGTLLDTEPTHRQAWTDVLARYGMRFDLQAMIALNGAPTWRIAQAVIE
RNHADLDPHLLAREKTDAVKAMLLDTVRPLPLIDVVKAWHGRRPMSVGTGSESAIAEALL
THLGLRHYFSAVVAADHVQNHKPAPDTFLRCAELMGVPAVKCVVFEDADFGIQAARDAGM
DVVDVRLL