Protein Info for MPMX20_03557 in Enterobacter sp. TBS_079
Annotation: Ribonucleoside-diphosphate reductase 2 subunit beta
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 87% identical to RIR4_SALTY: Ribonucleoside-diphosphate reductase 2 subunit beta (nrdF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K00526, ribonucleoside-diphosphate reductase beta chain [EC: 1.17.4.1] (inferred from 97% identity to enc:ECL_04016)MetaCyc: 87% identical to ribonucleoside-diphosphate reductase 2 subunit beta (Salmonella enterica enterica serovar Typhimurium)
Predicted SEED Role
"Ribonucleotide reductase of class Ib (aerobic), beta subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)
MetaCyc Pathways
- superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
- superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
- superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
- superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
- superpathway of purine nucleotide salvage (13/14 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
- superpathway of adenosine nucleotides de novo biosynthesis II (7/7 steps found)
- superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
- superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
- adenosine deoxyribonucleotides de novo biosynthesis II (4/4 steps found)
- guanosine deoxyribonucleotides de novo biosynthesis II (4/4 steps found)
- pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
- adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
- guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
- pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.17.4.1
Use Curated BLAST to search for 1.17.4.1
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (319 amino acids)
>MPMX20_03557 Ribonucleoside-diphosphate reductase 2 subunit beta (Enterobacter sp. TBS_079) MKLSRVSAVNWNKIQDDKDLEVWNRLTSNFWLPEKVPLSNDIPAWQTLSHAEQQLTIRVF TGLTLLDTIQNTVGAPALMADALTPHEEAVMSNISFMEAVHARSYSSIFSTLCQTKDVDA AYTWSEESESLQRKASLVLEYYQADEPLKKKIASVFLESFLFYSGFWLPMYWSSRGKLTN TADLIRLIIRDEAVHGYYIGYKYQKGLENVSEEKREALKGFALDLLMDLYENELSYTEEL YAGTGWEEEVKAFLCYNANKALMNLGYEALFPPEMADVNPAILAALSPNADENHDFFSGS GSSYVMGKAVETEDEDWDF