Protein Info for MPMX20_03413 in Enterobacter sp. TBS_079

Annotation: tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 TIGR00050: RNA methyltransferase, TrmH family, group 1" amino acids 39 to 279 (241 residues), 312.5 bits, see alignment E=1.1e-97 PF00588: SpoU_methylase" amino acids 43 to 192 (150 residues), 95.6 bits, see alignment E=1.5e-31

Best Hits

Swiss-Prot: 94% identical to TRMJ_SALPA: tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ (trmJ) from Salmonella paratyphi A (strain ATCC 9150 / SARB42)

KEGG orthology group: K02533, tRNA/rRNA methyltransferase [EC: 2.1.1.-] (inferred from 97% identity to enc:ECL_03881)

MetaCyc: 92% identical to tRNA Cm32/Um32 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11866 [EC: 2.1.1.200, 2.1.1.205]; 2.1.1.200 [EC: 2.1.1.200, 2.1.1.205]

Predicted SEED Role

"tRNA:Cm32/Um32 methyltransferase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.200 or 2.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>MPMX20_03413 tRNA (cytidine/uridine-2'-O-)-methyltransferase TrmJ (Enterobacter sp. TBS_079)
MLKNGKIGAEYSSEIGICLSFMIIWPNILQTQNPDIKTMLQNIRIVLVETSHTGNMGSVA
RAMKTMGLTNLWLVNPLVKPDSQAIALAAGASDVIGNAQIVDTLDEALAGCSLVVGTSAR
SRTLPWPMLDPRECGLKSVSEAEQAPVALVFGRERVGLTNDELQKCHYHVAIAANPEYSS
LNLAMAVQVIAYEVRMAWLATQEKATAEPQEEAVYPLVDDLERFYGHLEQTLLSTGFIRE
GHPGQVMNKLRRLFTRARPESQELNILRGILASIEQKNKE