Protein Info for MPMX20_03409 in Enterobacter sp. TBS_079

Annotation: Iron-binding protein IscA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 107 PF01521: Fe-S_biosyn" amino acids 1 to 103 (103 residues), 92.3 bits, see alignment E=1.2e-30 TIGR00049: iron-sulfur cluster assembly accessory protein" amino acids 3 to 107 (105 residues), 127.7 bits, see alignment E=2e-41 TIGR02011: iron-sulfur cluster assembly protein IscA" amino acids 3 to 107 (105 residues), 200.6 bits, see alignment E=4.1e-64

Best Hits

Swiss-Prot: 95% identical to ISCA_ENT38: Iron-binding protein IscA (iscA) from Enterobacter sp. (strain 638)

KEGG orthology group: K13628, iron-sulfur cluster assembly protein (inferred from 100% identity to enc:ECL_03877)

MetaCyc: 94% identical to iron-sulfur cluster insertion protein IscA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Iron binding protein IscA for iron-sulfur cluster assembly"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (107 amino acids)

>MPMX20_03409 Iron-binding protein IscA (Enterobacter sp. TBS_079)
MSITLSDSAAARVSSFLANRGKGFGLRLGVRTSGCSGMAYVLEFVDEPASDDTVFEDKGV
KVVVDGKSLQFLNGTQLDFVKEGLNEGFKFTNPNVKDECGCGESFHV