Protein Info for MPMX20_03373 in Enterobacter sp. TBS_079

Annotation: Myo-inositol 2-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 328 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR04380: inositol 2-dehydrogenase" amino acids 1 to 325 (325 residues), 449.5 bits, see alignment E=2.9e-139 PF01408: GFO_IDH_MocA" amino acids 2 to 119 (118 residues), 78.4 bits, see alignment E=1.1e-25 PF22725: GFO_IDH_MocA_C3" amino acids 127 to 246 (120 residues), 101.7 bits, see alignment E=4.3e-33 PF02894: GFO_IDH_MocA_C" amino acids 132 to 325 (194 residues), 73.2 bits, see alignment E=4.2e-24

Best Hits

Swiss-Prot: 50% identical to IOLG_THEMA: Myo-inositol 2-dehydrogenase (iolG) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: K00010, myo-inositol 2-dehydrogenase [EC: 1.1.1.18] (inferred from 96% identity to enc:ECL_03807)

MetaCyc: 50% identical to myo-inositol 2-dehydrogenase (Thermotoga maritima)
Inositol 2-dehydrogenase. [EC: 1.1.1.18]

Predicted SEED Role

"Myo-inositol 2-dehydrogenase 1 (EC 1.1.1.18)" in subsystem Inositol catabolism (EC 1.1.1.18)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.18

Use Curated BLAST to search for 1.1.1.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (328 amino acids)

>MPMX20_03373 Myo-inositol 2-dehydrogenase (Enterobacter sp. TBS_079)
MFNIALLGAGRIGQVHAANIASHIETTLWSVVDPNQEFATRLATQYQARLQSLEDAMSDP
NVHAVLIASATDTHADLIEMAARHGKAIFCEKPVHLDLARVRDCLKVVNEYNVPLFIGFN
RRFDPQFRRVKTEVQAGRIGKPESLLIISRDPSPPPAQYVRVSGGMFRDMTIHDFDMARF
IMGEEPVSVYAQGSNLVDPAIGEAGDIDTAFIVLKYASGAMATIVNSRRSSYGYDQRLEL
HGSEGLLCAGNILENQVQHYGKQGCTGALPEHFFLQRYKSAYAAEWEHFVAVLRGEATPD
CSGDDGERALYLADKALESLRSQREIVL