Protein Info for MPMX20_03322 in Enterobacter sp. TBS_079

Annotation: N-acetylmuramoyl-L-alanine amidase AmiA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details PF01520: Amidase_3" amino acids 61 to 275 (215 residues), 173.6 bits, see alignment E=2.1e-55

Best Hits

Swiss-Prot: 88% identical to AMIA_ECOLI: N-acetylmuramoyl-L-alanine amidase AmiA (amiA) from Escherichia coli (strain K12)

KEGG orthology group: K01448, N-acetylmuramoyl-L-alanine amidase [EC: 3.5.1.28] (inferred from 97% identity to enc:ECL_03758)

MetaCyc: 88% identical to N-acetylmuramoyl-L-alanine amidase A (Escherichia coli K-12 substr. MG1655)
N-acetylmuramoyl-L-alanine amidase. [EC: 3.5.1.28]

Predicted SEED Role

"N-acetylmuramoyl-L-alanine amidase (EC 3.5.1.28)" (EC 3.5.1.28)

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.28

Use Curated BLAST to search for 3.5.1.28

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>MPMX20_03322 N-acetylmuramoyl-L-alanine amidase AmiA (Enterobacter sp. TBS_079)
MSTFKPLKALTSRRQVLKAGLAALTLTGIAQQAQAKEESTLKTSNGHSKPKSKKPGAKRL
VMLDPGHGGIDTGAIGKNGAKEKHVVLAIAKNVRAILRSNGIDARLTRSGDTFIPLYDRV
EIAHQHGADLFMSIHADGFTNPSAAGASVFALSNRGASSAMAKYLSDRENRADEVAGKKA
TDKDHLLQQVLFDLVQTDTIKNSLTLGSHILKKIKPVHRLHSRSTEQAAFVVLKSPSIPS
VLVETSFITNPEEERLLGTTAFRQKIANAIASGIISYFNWFDNQKAHSRKR