Protein Info for MPMX20_03315 in Enterobacter sp. TBS_079

Annotation: Sulfate transport system permease protein CysW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 transmembrane" amino acids 20 to 43 (24 residues), see Phobius details amino acids 65 to 90 (26 residues), see Phobius details amino acids 102 to 124 (23 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 201 to 226 (26 residues), see Phobius details amino acids 249 to 272 (24 residues), see Phobius details TIGR00969: sulfate ABC transporter, permease protein" amino acids 2 to 275 (274 residues), 366.5 bits, see alignment E=8.6e-114 TIGR02140: sulfate ABC transporter, permease protein CysW" amino acids 19 to 276 (258 residues), 364.9 bits, see alignment E=2.4e-113 PF00528: BPD_transp_1" amino acids 82 to 267 (186 residues), 51 bits, see alignment E=7.6e-18

Best Hits

Swiss-Prot: 92% identical to CYSW_ECOLI: Sulfate transport system permease protein CysW (cysW) from Escherichia coli (strain K12)

KEGG orthology group: K02047, sulfate transport system permease protein (inferred from 97% identity to enc:ECL_03751)

MetaCyc: 92% identical to sulfate/thiosulfate ABC transporter inner membrane subunit CysW (Escherichia coli K-12 substr. MG1655)
ABC-19-RXN [EC: 7.3.2.5]; ABC-7-RXN [EC: 7.3.2.5, 7.3.2.3]; 7.3.2.3 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-478 [EC: 7.3.2.5, 7.3.2.3]; TRANS-RXN0-479 [EC: 7.3.2.5, 7.3.2.3]

Predicted SEED Role

"Sulfate transport system permease protein CysW" in subsystem Cysteine Biosynthesis

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.3.2.3 or 7.3.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (291 amino acids)

>MPMX20_03315 Sulfate transport system permease protein CysW (Enterobacter sp. TBS_079)
MAEVTQLKRYDAPRINWGKWFLIGTGVLVSAFILVVPTIYIFVQAFSKGLMPALENLANP
DMLHAIWLTVLIALITVPVNLVFGTLLAWLVTRFNFPGRQLLLTLLDIPFAVSPVVAGLV
YLLFYGSNGPLGGWLDEHNLQVMFAWPGMVLVTVFVTCPFVVRELVPVMLSQGSNEDEAA
ILLGASGWQMFRRVTLPNIRWALLYGVVLTNARAIGEFGAVSVVSGSIRGETLSLPLQIE
LLEQDYNTVGSFTAAALLTLMAILTLFLKSVVQWRLENQEKRQHQEGNHEH