Protein Info for MPMX20_03283 in Enterobacter sp. TBS_079

Annotation: Indole-3-pyruvate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03393: indolepyruvate decarboxylase
  • amino acids 5 to 543 (539 residues), 1065 bits, E=0
• PF02776: TPP_enzyme_N
  • amino acids 7 to 112 (106 residues), 97.4 bits, E=7.5e-32
• PF00205: TPP_enzyme_M
  • amino acids 203 to 323 (121 residues), 61.6 bits, E=1e-20
• PF02775: TPP_enzyme_C
  • amino acids 397 to 528 (132 residues), 71.9 bits, E=7.9e-24

Best Hits

Swiss-Prot: 100% identical to DCIP_ENTCL: Indole-3-pyruvate decarboxylase (ipdC) from Enterobacter cloacae

KEGG orthology group: K04103, indolepyruvate decarboxylase [EC: 4.1.1.74] (inferred from 92% identity to enc:ECL_03728)

MetaCyc: 100% identical to indole-3-pyruvate decarboxylase subunit (Enterobacter cloacae)
Indolepyruvate decarboxylase. [EC: 4.1.1.74]

Predicted SEED Role

"Pyruvate decarboxylase (EC 4.1.1.1); Alpha-keto-acid decarboxylase (EC 4.1.1.-)" (EC 4.1.1.-, EC 4.1.1.1)

MetaCyc Pathways

• superpathway of anaerobic sucrose degradation (17/19 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (9/9 steps found)
• pyruvate fermentation to acetate VIII (2/2 steps found)
• pyruvate fermentation to ethanol II (2/2 steps found)
• acetaldehyde biosynthesis II (1/1 steps found)
• L-methionine degradation III (2/3 steps found)
• indole-3-acetate biosynthesis VI (bacteria) (2/3 steps found)
• pyruvate fermentation to acetoin (2/3 steps found)
• L-tryptophan degradation VIII (to tryptophol) (2/4 steps found)
• long chain fatty acid ester synthesis (engineered) (2/4 steps found)
• butanol and isobutanol biosynthesis (engineered) (3/8 steps found)

KEGG Metabolic Maps

• 1,1,1-Trichloro-2,2-bis(4-chlorophenyl)ethane (DDT) degradation
• 1- and 2-Methylnaphthalene degradation
• 3-Chloroacrylic acid degradation
• Ascorbate and aldarate metabolism
• Benzoate degradation via hydroxylation
• Biphenyl degradation
• Fluorene degradation
• Glycolysis / Gluconeogenesis
• Phenylalanine metabolism
• Phenylpropanoid biosynthesis
• Purine metabolism
• Pyruvate metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.-

Use Curated BLAST to search for 4.1.1.- or 4.1.1.1 or 4.1.1.74

Protein Sequence (552 amino acids)

>MPMX20_03283 Indole-3-pyruvate decarboxylase (Enterobacter sp. TBS_079)
MRTPYCVADYLLDRLTDCGADHLFGVPGDYNLQFLDHVIDSPDICWVGCANELNASYAAD
GYARCKGFAALLTTFGVGELSAMNGIAGSYAEHVPVLHIVGAPGTAAQQRGELLHHTLGD
GEFRHFYHMSEPITVAQAVLTEQNACYEIDRVLTTMLRERRPGYLMLPADVAKKAATPPV
NALTHKQAHADSACLKAFRDAAENKLAMSKRTALLADFLVLRHGLKHALQKWVKEVPMAH
ATMLMGKGIFDERQAGFYGTYSGSASTGAVKEAIEGADTVLCVGTRFTDTLTAGFTHQLT
LAQTIEVQPHAARVGDVWFTGIPMNQAIETLVELCKQHVHAGLMSSSSGAIPFPQPDGSL
TQENFWRTLQTFIRPGDIILADQGTSAFGAIDLRLPADVNFIVQPLWGSIGYTLAAAFGA
QTACPNRRVIVLTGDGAAQLTIQELGSMLRDKQHPIILVLNNEGYTVERAIHGAEQRYND
IALWNWTHIPQALSLDPQSECWRVSEAEQLADVLEKVAHHERLSLIEVMLPKADIPPLLG
ALTKALEARNNA