Protein Info for MPMX20_03218 in Enterobacter sp. TBS_079

Annotation: NAD(P)H-quinone oxidoreductase subunit 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 13 to 37 (25 residues), see Phobius details amino acids 68 to 88 (21 residues), see Phobius details amino acids 99 to 122 (24 residues), see Phobius details PF00507: Oxidored_q4" amino acids 28 to 125 (98 residues), 109.8 bits, see alignment E=3.3e-36

Best Hits

Swiss-Prot: 95% identical to NUOA_ENT38: NADH-quinone oxidoreductase subunit A (nuoA) from Enterobacter sp. (strain 638)

KEGG orthology group: K00330, NADH dehydrogenase I subunit A [EC: 1.6.5.3] (inferred from 95% identity to ent:Ent638_2832)

MetaCyc: 93% identical to NADH:quinone oxidoreductase subunit A (Escherichia coli K-12 substr. MG1655)
NADH-DEHYDROG-A-RXN [EC: 7.1.1.2]; 7.1.1.- [EC: 7.1.1.2]

Predicted SEED Role

"NADH ubiquinone oxidoreductase chain A (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3 or 7.1.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>MPMX20_03218 NAD(P)H-quinone oxidoreductase subunit 3 (Enterobacter sp. TBS_079)
MSMSTSTEVIAHHWAFAIFLIVAIGLCCLMLVGGWFLGGRARARHKNTPFESGIDSVGSA
RLRLSAKFYLVAMFFVIFDVEALYLFAWSTSIRESGWVGFVEAAIFILVLLAGLVYLVRI
GALDWTPARSRREHINPENSISNRQQ