Protein Info for MPMX20_03191 in Enterobacter sp. TBS_079

Annotation: Sensor protein QseC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 signal peptide" amino acids 1 to 37 (37 residues), see Phobius details transmembrane" amino acids 170 to 192 (23 residues), see Phobius details PF08521: 2CSK_N" amino acids 21 to 169 (149 residues), 144.8 bits, see alignment E=3.8e-46 PF00512: HisKA" amino acids 247 to 306 (60 residues), 33.6 bits, see alignment E=6.4e-12 PF02518: HATPase_c" amino acids 358 to 465 (108 residues), 66.9 bits, see alignment E=4.3e-22 PF13581: HATPase_c_2" amino acids 362 to 443 (82 residues), 32 bits, see alignment E=2.3e-11

Best Hits

KEGG orthology group: K07649, two-component system, OmpR family, sensor histidine kinase TctE [EC: 2.7.13.3] (inferred from 90% identity to enc:ECL_03538)

Predicted SEED Role

"Tricarboxylate transport sensor protein TctE"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (469 amino acids)

>MPMX20_03191 Sensor protein QseC (Enterobacter sp. TBS_079)
MRWVKPQSLYLQLLLFLGLPLLLLWGLSAFNSYVSALQAATQAYDRTLLSSARTISERLE
VHDGRLGVNVPWVVLDSFELNMNDRLYYKVVDPDGRVISGYDDLPRMPPATSRTTLYPAL
AWFYHTEYRGQAIRVARLLQPVNEGNIVGMAEIYVAETLQSRRYLASQLLFSSWVSQGLL
VLLTLVLTAWLLRRVLRPMRQLSSLMVRRDPGLLAPLPELLPWSETRLLIVAFNRYIDRL
RGVLSRQERFNADASHQLKTPLAVLKTQVSVALMRQDPALWQESLRAMNATLDDTIVLTE
RLLQLSAVKRKEQGEGQFAPVDLVQVVQNCCFSRLAQARSKVIDLGYDGLQQPVMIEGDD
VLLGELCANLLENAIKYTPAEGTVTVFLRTDQGAVELSVEDSGPGIEEDQIQQAMLPFHR
LDNVGDAAGSGIGLALAADIARLHRSPLQLTRSETLGGLSVKMRFLLLT