Protein Info for MPMX20_03097 in Enterobacter sp. TBS_079

Annotation: Glycine betaine uptake system ATP-binding protein YehX

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF00005: ABC_tran" amino acids 19 to 162 (144 residues), 111.3 bits, see alignment E=5.8e-36

Best Hits

Swiss-Prot: 81% identical to YEHX_ECOLI: Glycine betaine uptake system ATP-binding protein YehX (yehX) from Escherichia coli (strain K12)

KEGG orthology group: K05847, osmoprotectant transport system ATP-binding protein (inferred from 93% identity to enc:ECL_03439)

MetaCyc: 81% identical to glycine betaine ABC transporter ATP binding subunit YehX (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-283

Predicted SEED Role

"Osmoprotectant ABC transporter ATP-binding subunit YehX"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>MPMX20_03097 Glycine betaine uptake system ATP-binding protein YehX (Enterobacter sp. TBS_079)
MIEFHDVSKTFAGRPAASHLNLNFAEGAFSVLIGTSGSGKSTTLKMINRLVEHDSGLIRF
AGEEIRSLPVLELRRRMGYAIQSIGLFPHWTVAQNIATVLQLEKWSRAKTADRVDELMSL
LGLEPALRDRYPHQLSGGQQQRVGVARALAANPQVLLMDEPFGALDPVTRAALQAEMTRI
HRILGRTIILVTHDIDEALRLADHLVLMDHGEVVQQGTPLELLTWPKNDFVREFFGRSEL
GVRLLSLRTVSDYMRRQDATVSGEPLQEQMSLRDALSAFVARQCEVLPVADARGAPSGTL
HFRDLLAGEVTREGTS