Protein Info for MPMX20_03058 in Enterobacter sp. TBS_079

Annotation: putative fimbrial chaperone EcpB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF18649: EcpB_C" amino acids 155 to 224 (70 residues), 91 bits, see alignment E=1.9e-30

Best Hits

Swiss-Prot: 47% identical to ECPB_KLEP3: Probable fimbrial chaperone EcpB (ecpB) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: None (inferred from 84% identity to enc:ECL_03399)

Predicted SEED Role

"CFA/I fimbrial auxiliary subunit"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>MPMX20_03058 putative fimbrial chaperone EcpB (Enterobacter sp. TBS_079)
MKKYLPLAALAGMVVSFSSLAINVGDITSIMTADQNALSKEIINTTDSARYVSVTVKRLS
SPLPDGTEMQFETSGELLSTPASLILPGEAKDVFRFFYKGPEDDKERYYRLQWVDEPVSE
SASTKAGKAAIATASAEIGTILVVAPRKERFEYGRDGDVITNKGNVSFRVIAYGACKEAS
QDRGRGCRERYYVMPGTKIRLQKSDVSNSRTRIGIWHGKQFITVK