Protein Info for MPMX20_03043 in Enterobacter sp. TBS_079

Annotation: Low molecular weight protein-tyrosine-phosphatase Wzb

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 PF01451: LMWPc" amino acids 4 to 145 (142 residues), 154.9 bits, see alignment E=8.5e-50

Best Hits

Swiss-Prot: 82% identical to WZB_SALTY: Low molecular weight protein-tyrosine-phosphatase Wzb (wzb) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 94% identity to enc:ECL_03384)

MetaCyc: 79% identical to protein-tyrosine phosphatase (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]

Predicted SEED Role

"Low molecular weight protein-tyrosine-phosphatase Wzb (EC 3.1.3.48)" in subsystem Colanic acid biosynthesis (EC 3.1.3.48)

Isozymes

Compare fitness of predicted isozymes for: 3.1.3.48

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>MPMX20_03043 Low molecular weight protein-tyrosine-phosphatase Wzb (Enterobacter sp. TBS_079)
MFNKILVVCVGNICRSPTAERLLKLYQPELTVDSAGLGALVGKGADERATSVARDHNLSL
DGHIARQVTGRMCREYDLILTMEKRHIHALCDIAPEMRGKVMLFGHWDNEREIPDPYRKS
HEAFEAVYTLLDQSARQWAQALKAQQG