Protein Info for MPMX20_03024 in Enterobacter sp. TBS_079

Annotation: UTP--glucose-1-phosphate uridylyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 298 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details TIGR01105: regulatory protein GalF" amino acids 1 to 296 (296 residues), 662 bits, see alignment E=4.7e-204 PF00483: NTP_transferase" amino acids 5 to 276 (272 residues), 92.7 bits, see alignment E=1.4e-30

Best Hits

Swiss-Prot: 94% identical to GALF_SALTY: UTP--glucose-1-phosphate uridylyltransferase (galF) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00963, UTP--glucose-1-phosphate uridylyltransferase [EC: 2.7.7.9] (inferred from 99% identity to enc:ECL_03365)

MetaCyc: 60% identical to UTP--glucose-1-phosphate uridylyltransferase (Escherichia coli K-12 substr. MG1655)
UTP-monosaccharide-1-phosphate uridylyltransferase. [EC: 2.7.7.64, 2.7.7.9]

Predicted SEED Role

"UTP--glucose-1-phosphate uridylyltransferase (EC 2.7.7.9)" (EC 2.7.7.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.7.9

Use Curated BLAST to search for 2.7.7.64 or 2.7.7.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (298 amino acids)

>MPMX20_03024 UTP--glucose-1-phosphate uridylyltransferase (Enterobacter sp. TBS_079)
MINLKAVIPVAGLGMHMLPATKAIPKEMLPIVDKPMIQYIVDEIVAAGIKEIVLVTHSSK
NAVENHFDTSYELEALLEQRVKRQLLAEVQSICPPGVTIMNVRQAQPLGLGHSILCARPV
VGDNPFIVVLPDIIIDSASADPLRYNLAAMVARFNETGRSQVLAKRMKGDLSEYSVIQTK
EALETEGQVSRIVEFIEKPDQPQTLDSDLMAVGRYVLNADIWAELEKTEPGAWDRIQLTD
AIAELAKKQSVDAMLMTGDSYDCGKKLGYMQAFVKYGLRNLKEGQKFRSRIEKLLAND