Protein Info for MPMX20_02837 in Enterobacter sp. TBS_079

Annotation: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 182 transmembrane" amino acids 7 to 25 (19 residues), see Phobius details amino acids 30 to 50 (21 residues), see Phobius details amino acids 64 to 83 (20 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 121 to 142 (22 residues), see Phobius details amino acids 148 to 170 (23 residues), see Phobius details TIGR00560: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase" amino acids 3 to 180 (178 residues), 209 bits, see alignment E=4e-66 PF01066: CDP-OH_P_transf" amino acids 3 to 166 (164 residues), 130.5 bits, see alignment E=3.6e-42

Best Hits

Swiss-Prot: 88% identical to PGSA_ECOL5: CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (pgsA) from Escherichia coli O6:K15:H31 (strain 536 / UPEC)

KEGG orthology group: K00995, CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase [EC: 2.7.8.5] (inferred from 96% identity to ent:Ent638_2499)

MetaCyc: 88% identical to CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Escherichia coli K-12 substr. MG1655)
CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase. [EC: 2.7.8.5]

Predicted SEED Role

"CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (EC 2.7.8.5)" in subsystem Glycerolipid and Glycerophospholipid Metabolism in Bacteria (EC 2.7.8.5)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.8.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (182 amino acids)

>MPMX20_02837 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (Enterobacter sp. TBS_079)
MQFNIPTLLTLFRVVLIPFFVLAFYLPVVWAPFACALIFLVAAVTDWFDGYLARRWNQST
RFGAFLDPVADKVMVAIAMVLVAEHYHTWWVTLPAATMIGREIIISALREWMAELGKRSS
VAVSWIGKVKTTAQMASLVWMLWRPNAWVEWAGIGLLWVAAVLTLWSMLQYLNAARGDLL
DQ