Protein Info for MPMX20_02747 in Enterobacter sp. TBS_079

Annotation: Inner membrane protein YebZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 289 transmembrane" amino acids 12 to 30 (19 residues), see Phobius details amino acids 50 to 73 (24 residues), see Phobius details amino acids 93 to 111 (19 residues), see Phobius details amino acids 118 to 137 (20 residues), see Phobius details amino acids 151 to 171 (21 residues), see Phobius details amino acids 193 to 214 (22 residues), see Phobius details amino acids 225 to 247 (23 residues), see Phobius details amino acids 268 to 286 (19 residues), see Phobius details PF05425: CopD" amino acids 185 to 282 (98 residues), 76.7 bits, see alignment E=8.3e-26

Best Hits

Swiss-Prot: 52% identical to YEBZ_ECOLI: Inner membrane protein YebZ (yebZ) from Escherichia coli (strain K12)

KEGG orthology group: K07245, putative copper resistance protein D (inferred from 82% identity to enc:ECL_01456)

Predicted SEED Role

"Copper resistance protein D" in subsystem Copper homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (289 amino acids)

>MPMX20_02747 Inner membrane protein YebZ (Enterobacter sp. TBS_079)
MLAMCYVGLRFLHFGALMLIFGNALYSVWFAPSSLQRLMSRRFQSQQRMAALISLVTALL
MFTLQGGLMGNGWGDVVNPDIWRSVLGTQFGSVWLWQIILAVLTAGTAWLAPHKGSRLLL
LAMGQFILLAGVGHATMNEGAVGALQRLNHALHVLCAATWLGGLLPLLFCMRLAKGQWQP
AAIYTMMRFSRVGHYAVAGVVLTGVFNALFILGIDIPWQARYVQFLLFKCALVALMVVIA
LANRYFLVPRFRAQSGREQQIFIRMTQAEVVLGALVLATVSLFATWEPF