Protein Info for MPMX20_02739 in Enterobacter sp. TBS_079

Annotation: Free methionine-R-sulfoxide reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01590: GAF
  • amino acids 28 to 149 (122 residues), 46.2 bits, E=6.8e-16
• PF13185: GAF_2
  • amino acids 32 to 151 (120 residues), 44.9 bits, E=1.4e-15

Best Hits

Swiss-Prot: 90% identical to MSRC_ECOLI: Free methionine-R-sulfoxide reductase (msrC) from Escherichia coli (strain K12)

KEGG orthology group: K07170, GAF domain-containing protein (inferred from 98% identity to enc:ECL_01469)

MetaCyc: 90% identical to free methionine-(R)-sulfoxide reductase (Escherichia coli K-12 substr. MG1655)
L-methionine (R)-S-oxide reductase. [EC: 1.8.4.14]

Predicted SEED Role

"Free methionine-(R)-sulfoxide reductase, contains GAF domain"

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.14

Protein Sequence (165 amino acids)

>MPMX20_02739 Free methionine-R-sulfoxide reductase (Enterobacter sp. TBS_079)
MNKTEFYADLNRDFKALMAGETSFLATLANTSALLFERLSDVNWAGFYLLEGETLVLGPF
QGKIACVRIPVGRGVCGTAVATNQVQRVEDVHAFDGHIACDAASNSEIVLPLVVKNQIIG
VLDIDSTVFSRFTTEDEQGLRELVANLENVLAATDYQKFFASVAG