Protein Info for MPMX20_02633 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 269 PF13369: Transglut_core2" amino acids 34 to 184 (151 residues), 148.5 bits, see alignment E=1.1e-47 PF13371: TPR_9" amino acids 187 to 259 (73 residues), 84.3 bits, see alignment E=4.9e-28

Best Hits

Swiss-Prot: 85% identical to SIRB1_SALTI: Protein SirB1 (sirB1) from Salmonella typhi

KEGG orthology group: None (inferred from 98% identity to enc:ECL_01600)

Predicted SEED Role

"FIG002708: Protein SirB1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (269 amino acids)

>MPMX20_02633 hypothetical protein (Enterobacter sp. TBS_079)
MRSLADFEFNKVPLCDGMILISEMIRDDFTSQYVYEELENLVSLAREEINQARPQDWQLE
KLLELFYGEWGFCDTRGVYRLSDALWLDQVLKNRQGSAVALGSILLWVAHRLDIPLVPVI
FPTQMILRAEWLDGEMWLINPFNGDTLDEHTLDVWLKGNISPVAELFNEDLDEADNAEVI
RKLLDTLKSALMEERQMELALRASEVLLQFNPEDPYEIRDRGLIYAQLDCEHVALNDLNY
FVEQCPEDPISEMIRAQINAISHKQITLH