Protein Info for MPMX20_02610 in Enterobacter sp. TBS_079

Annotation: 2-alkyl-3-oxoalkanoate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF04321: RmlD_sub_bind" amino acids 1 to 189 (189 residues), 47.7 bits, see alignment E=5.2e-16 PF00106: adh_short" amino acids 3 to 69 (67 residues), 29.6 bits, see alignment E=2.2e-10 PF05368: NmrA" amino acids 3 to 114 (112 residues), 30 bits, see alignment E=1.6e-10 PF01370: Epimerase" amino acids 3 to 221 (219 residues), 111.5 bits, see alignment E=2e-35 PF16363: GDP_Man_Dehyd" amino acids 4 to 158 (155 residues), 31.2 bits, see alignment E=7.6e-11 PF01073: 3Beta_HSD" amino acids 5 to 258 (254 residues), 66.2 bits, see alignment E=1.1e-21 PF13460: NAD_binding_10" amino acids 7 to 172 (166 residues), 71.8 bits, see alignment E=3.1e-23 PF07993: NAD_binding_4" amino acids 59 to 168 (110 residues), 40 bits, see alignment E=1.2e-13

Best Hits

KEGG orthology group: None (inferred from 72% identity to efe:EFER_1731)

Predicted SEED Role

"FIG036672: Nucleoside-diphosphate-sugar epimerase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (338 amino acids)

>MPMX20_02610 2-alkyl-3-oxoalkanoate reductase (Enterobacter sp. TBS_079)
MKILVTGATSGLGRNAVHYLLERGFSVVATGRNPVEGAHLRHVGATFIPLDLSLASLDQC
ARLMEGCDAVWHCAAKSSPWGGRDAFWQANVIATKKLAMAAGTAGIPRFVHISTPAVYFD
FQHHYDLPETYLANTFSSHYASSKRAAERIIEDAVANFSATTFIILRPRGLFGPHDKVIV
PRLLRQLHQDGGVLRLPRGGEALLDLTFVQNVVFAMERATLGQPLYSGSIYNVTNHQPQR
LVDMLDALLRQQLGLRYQIRSIPWPVVSLAARGMELVGKCINKEPPVTRYSAGTVCFDMT
LSAKKAVEELGYIPRFSMAEGIALTGEWLRTNGKDYRV