Protein Info for MPMX20_02593 in Enterobacter sp. TBS_079

Annotation: Regulator of RpoS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 PF00072: Response_reg" amino acids 10 to 119 (110 residues), 97.3 bits, see alignment E=3.1e-32

Best Hits

Swiss-Prot: 83% identical to RSSB_SHIFL: Regulator of RpoS (rssB) from Shigella flexneri

KEGG orthology group: K02485, two-component system, unclassified family, response regulator (inferred from 96% identity to enc:ECL_01631)

Predicted SEED Role

"Hnr protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>MPMX20_02593 Regulator of RpoS (Enterobacter sp. TBS_079)
MTKPLAGKHILIVEDEPVFRSLLDSWLSSLGANTSLADDGIDALEKMVNITPDLMICDLE
MPRMNGLKLVEHLRNEANQMPILVISATENMADIAKALRLGVQDILLKPVKDLNRLRETV
LACLYPNMFNSRVEEEERLFQDWDALVSNPPAAAKLLQELQPPVQQNISHCRVNYRQLVA
ADQPGLVLDIAPLSDSDLAFYCLDVTRAGDNGVLAALLLRALFNGLLQEQLSHQGQRLPE
LGSLLKQVNQLFRQANLPGQFPLLVGYYHSGLKNLILVSAGLNASLNTGEHHIQVSNGVP
LGTLGTAYLNQISHRCSSWQCQIWGAGGRLRLMLSTE