Protein Info for MPMX20_02574 in Enterobacter sp. TBS_079

Annotation: putative intracellular septation protein A

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 179 transmembrane" amino acids 20 to 41 (22 residues), see Phobius details amino acids 50 to 68 (19 residues), see Phobius details amino acids 75 to 96 (22 residues), see Phobius details amino acids 117 to 139 (23 residues), see Phobius details amino acids 149 to 170 (22 residues), see Phobius details TIGR00997: intracellular septation protein A" amino acids 1 to 177 (177 residues), 247.8 bits, see alignment E=3.9e-78 PF04279: IspA" amino acids 1 to 175 (175 residues), 250.9 bits, see alignment E=4.4e-79

Best Hits

Swiss-Prot: 94% identical to YCIB_KLEP3: Probable intracellular septation protein A (KPK_3196) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K06190, intracellular septation protein (inferred from 92% identity to ecm:EcSMS35_1878)

Predicted SEED Role

"Intracellular septation protein IspA"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (179 amino acids)

>MPMX20_02574 putative intracellular septation protein A (Enterobacter sp. TBS_079)
MKQFLDFLPLVVFFAFYKLYDIYAATTALIVATAVVLIYSWVRYRKVEKMALVTFVLVAV
FGGLTLFFHNDEFIKWKVTVIYALFAGALLISQWVMKKPLIQRMLGKELTLPQEVWSRLN
IAWAIFFILCGLANIYIAFWLPQNIWVNFKVFGLTALTLIFTLLSGVYIYRHMPQDDQH