Protein Info for MPMX20_02557 in Enterobacter sp. TBS_079

Annotation: N-acyl homoserine lactonase AttM

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 PF00753: Lactamase_B" amino acids 34 to 247 (214 residues), 65.6 bits, see alignment E=3.1e-22

Best Hits

Swiss-Prot: 59% identical to AHLLM_AGRFC: N-acyl homoserine lactonase AttM (attM) from Agrobacterium fabrum (strain C58 / ATCC 33970)

KEGG orthology group: None (inferred from 68% identity to kpe:KPK_2642)

Predicted SEED Role

"N-acyl homoserine lactone hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>MPMX20_02557 N-acyl homoserine lactonase AttM (Enterobacter sp. TBS_079)
MSDIRLYMFQSGYQRCKYHDIRMNQGEGSDYIIPVPWFLLTHPQGNVVIDGGLAVEGLKD
PRAYWGPTVDQYHPIMDTNQGCRRQLAKLGIRPESVRYVLLSHLHSDHTGAIGRFPEATH
LVQRAEYDYAFSPDWFTAGAYCRKDFHREGLKWQFLAGDADDGFDLYRDGVLKIIYTPGH
SPGHQSFVVSLPSGKSFTLAIDAAYTLDHFQDKALPGLMTSASEVARSVAKLRVVTQMHN
AEIIPGHDPDIWPHYAMKTEGYN