Protein Info for MPMX20_02543 in Enterobacter sp. TBS_079

Annotation: NADH dehydrogenase-like protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 401 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 4 to 313 (310 residues), 138.2 bits, see alignment E=7.8e-44 PF00070: Pyr_redox" amino acids 156 to 233 (78 residues), 35.7 bits, see alignment E=2e-12

Best Hits

Swiss-Prot: 44% identical to Y1812_MYCTO: NADH dehydrogenase-like protein MT1860 (MT1860) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: K03885, NADH dehydrogenase [EC: 1.6.99.3] (inferred from 61% identity to bid:Bind_0321)

Predicted SEED Role

"NADH dehydrogenase (EC 1.6.99.3)" in subsystem Carboxysome or Respiratory dehydrogenases 1 (EC 1.6.99.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.99.3

Use Curated BLAST to search for 1.6.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (401 amino acids)

>MPMX20_02543 NADH dehydrogenase-like protein (Enterobacter sp. TBS_079)
MKKRIIIAGSGFAGMWAAISAARLVHMEKANDRIEIFLVSPEPALTIRPRLYEAVLENMA
PSILHVLEAAGVHYIAGYVTDIDAENKTISVKKESGETSVNFDSFVLATGSQAFHPDLPG
ITEYSFDVNSLNAAHELEQHLMSLASEPDSPARNTVVVAGGGLTGLETATEMPERLRDLL
GSEHHLQVIIVDSSNKIGQAMGEDACEIINQALASNGVTVRTGVRVRAINAEGVMLSDDE
FIPSKTVIWTAGMRASALAALIPGDHDNLGRVIGDAYLRAPAARGIFVTGDTVKVPTDDE
GNYNVMSCQHAMSLGRVAGHNAAAEILGLPLHLYSQPKYVTCLDLGKWGAVYTEGWDHQV
MYQGMEAKKIKQEINTEWIYPPEPDREKMFSVANPDYIIVP