Protein Info for MPMX20_02528 in Enterobacter sp. TBS_079

Annotation: Miniconductance mechanosensitive channel YbdG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 418 transmembrane" amino acids 17 to 41 (25 residues), see Phobius details amino acids 69 to 85 (17 residues), see Phobius details amino acids 92 to 116 (25 residues), see Phobius details amino acids 136 to 157 (22 residues), see Phobius details amino acids 163 to 185 (23 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 184 to 250 (67 residues), 50.8 bits, see alignment E=7.6e-18

Best Hits

KEGG orthology group: None (inferred from 90% identity to eae:EAE_19250)

Predicted SEED Role

"Small-conductance mechanosensitive channel"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (418 amino acids)

>MPMX20_02528 Miniconductance mechanosensitive channel YbdG (Enterobacter sp. TBS_079)
MVYLDYLLTFIESNPALAIGFNLILLVISGFFAHLMCKFLLIKIVRKVFFASHKQDVPLE
KDRRIAEKLSNFIPVIIVYYVLQFMPNMPASLVTAINTICGILFFIFLSVFFNEMLDIVN
SSYLRKTKRKNHSIKGYIQIGKIFIHVIAAIMILAVMSNKSPAIIISSLGAVAAVLMLVF
QHTLLSLVANIQLSSNDVLQLGDWIEMPDKNLSGEVTDIALHTITIRNWDNTISRIPTKN
FLTETYTNWQAMFSSGARRIMRSTTIDQHSVTFLTQETLAPMLALRGTNEPLAKLIDGRD
PMGVPDSWFMDNGLTNLTLFRHYLMAWLADRPDIIKDMYIVVRTLKPTPSGIPLEIYCFT
SSVLWMEYENTQSAIFEYITAVAGQFSLRLYQYPAGHDFWRLSQEHSLRDRTPPPGEG