Protein Info for MPMX20_02283 in Enterobacter sp. TBS_079

Annotation: Protein DipZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 396 transmembrane" amino acids 6 to 29 (24 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 115 to 142 (28 residues), see Phobius details amino acids 150 to 173 (24 residues), see Phobius details amino acids 194 to 214 (21 residues), see Phobius details PF02683: DsbD_TM" amino acids 3 to 202 (200 residues), 39.1 bits, see alignment E=1.1e-13 PF08534: Redoxin" amino acids 263 to 384 (122 residues), 43.4 bits, see alignment E=6.2e-15 PF00578: AhpC-TSA" amino acids 264 to 372 (109 residues), 48.6 bits, see alignment E=1.6e-16 PF13905: Thioredoxin_8" amino acids 275 to 369 (95 residues), 30 bits, see alignment E=1.1e-10

Best Hits

KEGG orthology group: None (inferred from 90% identity to enc:ECL_01975)

Predicted SEED Role

"FIG00731668: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (396 amino acids)

>MPMX20_02283 Protein DipZ (Enterobacter sp. TBS_079)
MFLIIAFLGGMISLLSPCTLPVIPLLFAGFQGQRRHILALLAGMIVMFTVVAMVVTAASE
WITDATIIGRWLALIILATAALALIFPSFAQRIAGPAVSAGNILNTRSGQTRGMFSAFLA
GLAVGLLWSPCAGPILGAIFSINIADHSAITTGALLAAYGSGCALMLGLLMAGGRKLMAP
LRAKSALMERLRKGAGVVMLAAVAFNATGMNSVLKGANGVADRLETTLLTLAKPATAPVK
LQPVVMTEPSSQLPSLSGGTGWVNGDPVTSESLRGKVVLIDFWTWDCINCQHTLPHVRDW
ATRYQSQGLVVIGVHTPEYPWEKPLSSVKNAVNKWQLPYRVVTDNNYQIWNAFGNQYWPA
HYYFDAKGQLRYTSFGEGNYEEQEKVIQQLLKEARS