Protein Info for MPMX20_02267 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 160 PF00583: Acetyltransf_1" amino acids 27 to 129 (103 residues), 62.1 bits, see alignment E=1.2e-20 PF13673: Acetyltransf_10" amino acids 50 to 131 (82 residues), 32 bits, see alignment E=2.3e-11 PF13508: Acetyltransf_7" amino acids 58 to 131 (74 residues), 50.1 bits, see alignment E=6e-17 PF08445: FR47" amino acids 67 to 132 (66 residues), 24.2 bits, see alignment E=5.6e-09

Best Hits

Swiss-Prot: 45% identical to IAAT_AZOBR: IAA acetyltransferase from Azospirillum brasilense

KEGG orthology group: K03829, putative acetyltransferase [EC: 2.3.1.-] (inferred from 91% identity to enc:ECL_01994)

Predicted SEED Role

"GCN5-related N-acetyltransferase"

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (160 amino acids)

>MPMX20_02267 hypothetical protein (Enterobacter sp. TBS_079)
MYSITAESAHHPDILHLIAALDRYQSELYPAESNHLLDLTELPTASLILMIIRDRQLHAV
GCGAVVLNGDGTGEMKRVYIDPAHRGQHLGEMLLAALEDEALSRHCHTLRLETGIRQHAA
VRLYEQCGYEQRPAFPPYVDDPLSLFMEKALVVDVRLAAL