Protein Info for MPMX20_02257 in Enterobacter sp. TBS_079

Annotation: putative amino-acid metabolite efflux pump

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 transmembrane" amino acids 7 to 27 (21 residues), see Phobius details amino acids 33 to 52 (20 residues), see Phobius details amino acids 61 to 82 (22 residues), see Phobius details amino acids 88 to 108 (21 residues), see Phobius details amino acids 117 to 135 (19 residues), see Phobius details amino acids 141 to 162 (22 residues), see Phobius details amino acids 174 to 196 (23 residues), see Phobius details amino acids 213 to 232 (20 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details PF00892: EamA" amino acids 7 to 130 (124 residues), 59.8 bits, see alignment E=1.7e-20 amino acids 143 to 286 (144 residues), 59.1 bits, see alignment E=2.8e-20

Best Hits

Swiss-Prot: 83% identical to EAMA_ECOLI: Probable amino-acid metabolite efflux pump (eamA) from Escherichia coli (strain K12)

KEGG orthology group: K03298, drug/metabolite transporter, DME family (inferred from 95% identity to enc:ECL_02010)

MetaCyc: 83% identical to cysteine/O-acetylserine exporter EamA (Escherichia coli K-12 substr. MG1655)
RXN0-1923; RXN0-1924

Predicted SEED Role

"Permease of the drug/metabolite transporter (DMT) superfamily" in subsystem Queuosine-Archaeosine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (299 amino acids)

>MPMX20_02257 putative amino-acid metabolite efflux pump (Enterobacter sp. TBS_079)
MTRKDGLLALLVVIVWGLNFVVIKLGLHNMPPLMLAGLRFLLVAFPALFFVARPKIPFRL
LLGYGLTISFGQFAFLFCAIKFGMPAGLASLVLQAQAFFTIILGAFVFDERLQGKQLAGI
TLAVFGVLVLIEASLNGQHVALLGFMLTLAAGLSWACGNIFNKLIMQHEARPKVMSLVVW
SALIPIVPFMVAALIFDGPDVMLKSLVEIDLTTILSLIYLAFVATIIGYGIWGSLLGRYE
TWRVAPLSLLVPVVGLASAALLLDEKLSALQLLGAVLIMAGLYINVFGLRVRRVTRARG