Protein Info for MPMX20_02214 in Enterobacter sp. TBS_079

Annotation: Protein YgiW

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 129 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details TIGR00156: TIGR00156 family protein" amino acids 2 to 129 (128 residues), 136.3 bits, see alignment E=3e-44 PF04076: BOF" amino acids 29 to 129 (101 residues), 107.2 bits, see alignment E=2.2e-35

Best Hits

Swiss-Prot: 63% identical to YDEI_ECOLI: Uncharacterized protein YdeI (ydeI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to enc:ECL_02054)

Predicted SEED Role

"FIG00638667: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (129 amino acids)

>MPMX20_02214 Protein YgiW (Enterobacter sp. TBS_079)
MKLSLISAFLIFLVPAAWADNNGGLQKGEAPPPPHALDSGYRGTDDARIMTIDHAKEMHD
GATISLRGNLIDGSGDKFVFQDKTGKIDVIIPQAVFDGRTVKPDQMISINGSLDKKSSPP
VVRVDHLQK