Protein Info for MPMX20_02143 in Enterobacter sp. TBS_079

Annotation: 1,2-phenylacetyl-CoA epoxidase, subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 95 PF06243: PaaB" amino acids 6 to 91 (86 residues), 147.1 bits, see alignment E=7e-48 TIGR02157: phenylacetate-CoA oxygenase, PaaH subunit" amino acids 6 to 95 (90 residues), 163.5 bits, see alignment E=4.7e-53

Best Hits

Swiss-Prot: 97% identical to PAAB_ECOLI: 1,2-phenylacetyl-CoA epoxidase, subunit B (paaB) from Escherichia coli (strain K12)

KEGG orthology group: K02610, phenylacetic acid degradation protein (inferred from 97% identity to eco:b1389)

MetaCyc: 97% identical to phenylacetyl-CoA 1,2-epoxidase subunit B (Escherichia coli K-12 substr. MG1655)
RXN0-2042 [EC: 1.14.13.149]

Predicted SEED Role

"Phenylacetate-CoA oxygenase, PaaH subunit"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.13.149

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (95 amino acids)

>MPMX20_02143 1,2-phenylacetyl-CoA epoxidase, subunit B (Enterobacter sp. TBS_079)
MSNVYWPLYEVFVRSKQGLSHRHVGSLHAADDRMALENARDAYTRRSEGCSIWVVKASEI
VASQPEESGEFFDPAESKVYRHPTFYTIPDGIEHM