Protein Info for MPMX20_02069 in Enterobacter sp. TBS_079

Annotation: Osmoprotectant import permease protein OsmY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 236 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 89 to 119 (31 residues), see Phobius details amino acids 125 to 144 (20 residues), see Phobius details amino acids 165 to 186 (22 residues), see Phobius details amino acids 205 to 227 (23 residues), see Phobius details PF00528: BPD_transp_1" amino acids 60 to 232 (173 residues), 83.7 bits, see alignment E=7e-28

Best Hits

Swiss-Prot: 87% identical to OSMY_SALTY: Osmoprotectant import permease protein OsmY (osmY) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K05846, osmoprotectant transport system permease protein (inferred from 97% identity to enc:ECL_02213)

Predicted SEED Role

"Putative ABC transporter membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (236 amino acids)

>MPMX20_02069 Osmoprotectant import permease protein OsmY (Enterobacter sp. TBS_079)
MHPLLKRSLLFVGAIIVVVALLTWGIGLDTIKARQVDLIYLGQQHLILVFSSMFFALLIG
IPSGILLSRPSARGIAEYVMQIFNVGNTLPPLAVLALAMVVIGIGDTPAIIALFLASLLP
IVRNTYAGLCSVPASLLEAANGIGMTKWQRLRQVELPNAWPVMLSGIRIATAINVGTAPL
AFLIGASSYGELIFPGIYLNDFPTLILGAAATALFALILDTLLAALGRVMSPHLAR