Protein Info for MPMX20_02064 in Enterobacter sp. TBS_079

Annotation: ATP-dependent dethiobiotin synthetase BioD 1

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13500: AAA_26
  • amino acids 3 to 206 (204 residues), 109.4 bits, E=2.1e-35
• PF01656: CbiA
  • amino acids 6 to 205 (200 residues), 58.1 bits, E=9e-20
• TIGR00347: dethiobiotin synthase
  • amino acids 6 to 172 (167 residues), 133.5 bits, E=3.9e-43

Best Hits

Swiss-Prot: 88% identical to BIOD2_SALTI: ATP-dependent dethiobiotin synthetase BioD 2 (bioD2) from Salmonella typhi

KEGG orthology group: K01935, dethiobiotin synthetase [EC: 6.3.3.3] (inferred from 95% identity to enc:ECL_02219)

MetaCyc: 88% identical to dethiobiotin synthetase BidA (Escherichia coli K-12 substr. MG1655)
Dethiobiotin synthase. [EC: 6.3.3.3]

Predicted SEED Role

"Dethiobiotin synthetase (EC 6.3.3.3)" in subsystem Biotin biosynthesis (EC 6.3.3.3)

MetaCyc Pathways

• biotin biosynthesis I (15/15 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate I (4/4 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate II (3/4 steps found)
• biotin biosynthesis II (4/6 steps found)
• biotin biosynthesis from 8-amino-7-oxononanoate III (3/5 steps found)

KEGG Metabolic Maps

• Biotin metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.3.3

Use Curated BLAST to search for 6.3.3.3

Protein Sequence (231 amino acids)

>MPMX20_02064 ATP-dependent dethiobiotin synthetase BioD 1 (Enterobacter sp. TBS_079)
MLKRFFVTGTDTSVGKTVVSRALLQALAASGKRVAGYKPVAKGSKETPEGLRNKDALVLQ
SVSSLELPYHAINPIALSEDESSVAHSGLINYTLLSDGLANLSEMADHVVVEGTGGWRSL
MNDLRPLSEWVVQEQLPVIMVVGIQEGCINHALLTAQAIANDGLPLIGWVANRINPGLAH
YAEIIDVLSKKLPGPLVGELPYLPRAEQRELAQYIDLSSLGRMLSVDRVVA