Protein Info for MPMX20_02054 in Enterobacter sp. TBS_079

Annotation: Spermidine export protein MdtJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 130 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 42 to 61 (20 residues), see Phobius details amino acids 68 to 89 (22 residues), see Phobius details amino acids 95 to 113 (19 residues), see Phobius details PF00893: Multi_Drug_Res" amino acids 13 to 103 (91 residues), 99.5 bits, see alignment E=6.6e-33

Best Hits

Swiss-Prot: 92% identical to MDTJ_ENT38: Spermidine export protein MdtJ (mdtJ) from Enterobacter sp. (strain 638)

KEGG orthology group: K11743, spermidine export protein MdtJ (inferred from 97% identity to enc:ECL_02236)

MetaCyc: 86% identical to multidrug/spermidine efflux pump membrane subunit MdtJ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-350; TRANS-RXN0-266

Predicted SEED Role

"Spermidine export protein MdtJ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (130 amino acids)

>MPMX20_02054 Spermidine export protein MdtJ (Enterobacter sp. TBS_079)
MDYILKQEKNMFYWILLALAIIAEITGTLSMKWASVSDGNTGFILMLVMISLSYIFLSFA
VKKIALGVAYALWEGIGILLITLFSVLLFDETLSTMKIAGLTTLVAGIVLIKSGTRKPTK
QPKEQTHAAV