Protein Info for MPMX20_02033 in Enterobacter sp. TBS_079

Annotation: Universal stress protein E

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 PF00582: Usp" amino acids 4 to 146 (143 residues), 76.4 bits, see alignment E=1.7e-25 amino acids 172 to 300 (129 residues), 56.3 bits, see alignment E=2.7e-19

Best Hits

Swiss-Prot: 94% identical to USPE_SALTY: Universal stress protein E (uspE) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K14055, universal stress protein E (inferred from 99% identity to enc:ECL_02261)

Predicted SEED Role

"Universal stress protein E" in subsystem Universal stress protein family

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>MPMX20_02033 Universal stress protein E (Enterobacter sp. TBS_079)
MAKYQNMLVAIDPNQDDQPALRRAVYLHQRIGGKIKAFLPIYDFSYEMTTLLSPDERTAM
RQGVISQRTAWIREQAKYYLEAGVPIDIKVVWHNRPFEAIIQEVVAGGHDLLLKMAHQHD
KLESVIFTPTDWHLLRKCPCPVWMVKDQPWPEGGKAVVAVNLASEEDYHNSLNEKLVKET
IQLAEQVNHTEVHLVGAYPVTPINIAIELPEFDPSVYNDAIRGQHLLAMKALRQKFSIDE
KMTHVEKGLPEEVIPDLAEHLQAGIVVLGTIGRTGISAAFLGNTAEQVIDHLRCDLLVIK
PDEYQTPVELDDPEDD