Protein Info for MPMX20_02012 in Enterobacter sp. TBS_079

Annotation: Inner membrane protein YdgK

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 146 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 55 to 78 (24 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 114 to 133 (20 residues), see Phobius details PF10754: DUF2569" amino acids 7 to 144 (138 residues), 142.2 bits, see alignment E=8e-46

Best Hits

Swiss-Prot: 74% identical to YDGK_ECOLI: Inner membrane protein YdgK (ydgK) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 97% identity to enc:ECL_02305)

Predicted SEED Role

"Putative membrane protein precursor"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (146 amino acids)

>MPMX20_02012 Inner membrane protein YdgK (Enterobacter sp. TBS_079)
MTATPGERIGGWLIAPLAWLLVALLSASLALLLYTTALITPHAIQTLMSQSVLNITMWFV
SFVFAIGMWYYTLWLTIAFFKRRKGVPKHYIIWLLISVLLAVKAFAFSPVSDALAVRQLL
FPLLAAALLVPYFKRSTRVKNTFVNP