Protein Info for MPMX20_01946 in Enterobacter sp. TBS_079

Annotation: FeS cluster assembly protein SufD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 TIGR01981: FeS assembly protein SufD" amino acids 133 to 408 (276 residues), 292.7 bits, see alignment E=1.3e-91 PF01458: SUFBD_core" amino acids 165 to 393 (229 residues), 263 bits, see alignment E=1.1e-82

Best Hits

Swiss-Prot: 83% identical to SUFD_ECOLI: FeS cluster assembly protein SufD (sufD) from Escherichia coli (strain K12)

KEGG orthology group: K09015, Fe-S cluster assembly protein SufD (inferred from 92% identity to enc:ECL_02367)

Predicted SEED Role

"Iron-sulfur cluster assembly protein SufD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>MPMX20_01946 FeS cluster assembly protein SufD (Enterobacter sp. TBS_079)
MAGLPNSSNALQQWHRLFEAQGNTRSEQAQQHLQQMLRLGLPSRKQENWKYTPLDGLLNG
EFVTRLADISPAQRDALALTVDAVRLVFVDGQFRPELSDSTQDCGFEIAINDDRQSLSTP
VQPEVFLHLTESLARSVTHIRVKRNQRPVKPLLLMHITQGADGDEINTAHYRHHLELAEG
AEATVIEHYVSLNDTRHFTGARLTMHVAANAQLHHIKLAFENPQSHHFAHNDMLLGQDAA
AYSHSFLLGGTVLRHNTSTQLNGENTTLRINSLAMPVKTQVCDTRTWLEHNKGYCNSRQL
HKTIVSDKGRAVFNGLINVAQHAIKTDGQMTNNNLLLGRLAEVDTKPQLEIYADDVKCSH
GATVGRIDDEQMFYLRSRGIDQQAAQQMIIYAFAAELTEALHDGLLKQQVLARIGQRLPG
GEA