Protein Info for MPMX20_01941 in Enterobacter sp. TBS_079

Annotation: Blue light- and temperature-regulated antirepressor BluF

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 PF04940: BLUF" amino acids 2 to 92 (91 residues), 91.5 bits, see alignment E=3.2e-30 PF00563: EAL" amino acids 172 to 389 (218 residues), 158.3 bits, see alignment E=2.2e-50

Best Hits

KEGG orthology group: None (inferred from 91% identity to enc:ECL_02372)

Predicted SEED Role

"Hypothetical protein ycgF"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>MPMX20_01941 Blue light- and temperature-regulated antirepressor BluF (Enterobacter sp. TBS_079)
MLTTIIYRSHICEDVPVKALENMVAAANSKNRQSNVTGILLFNGTHFFQLLEGPAENVSS
IYEQICQDTRHHNVVELMRDHGPSRRFGKVGMELFDLRQFDREEVLQQVLDKGTSRYQLT
YSDRALQFFRTFVEATEKANYFELPPADAWDFIPEETPLSAQPEVVAKGADCSFAFQPIV
DPFMQQVVSWEALIRTPTGESPGTYFAQIPREEVYASDLKSKQVALSMASALGLQDQTLS
INLLPMTLVNVPGAVDFLLTAIDANGFVPEQIVVEFTESEAISRFEEFTHSVRQLKSAGI
SVTIDHFGAGFAGLQLLAQFQPDRIKINRDLVANVHKSGPRQAIIQAIITCCSSLEIQFC
AVGVEKPEEWMWLESAGISQFQGHLFASPRHGGIPAIAWPEKKFEF