Protein Info for MPMX20_01921 in Enterobacter sp. TBS_079

Annotation: Phosphoenolpyruvate synthase regulatory protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 277 PF03618: Kinase-PPPase" amino acids 9 to 267 (259 residues), 253.5 bits, see alignment E=1.3e-79

Best Hits

Swiss-Prot: 97% identical to PSRP_ENT38: Putative phosphoenolpyruvate synthase regulatory protein (Ent638_1744) from Enterobacter sp. (strain 638)

KEGG orthology group: K09773, hypothetical protein (inferred from 99% identity to enc:ECL_02393)

Predicted SEED Role

"FIG137360: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (277 amino acids)

>MPMX20_01921 Phosphoenolpyruvate synthase regulatory protein (Enterobacter sp. TBS_079)
MDNAVDRHVFYISDGTAITAEVLGHAVMSQFPVSINSITLPFVENESRAKAVKDQIDAIF
QQTGVRPLVFYSIVIPEIRAIILQSEGFCQDIVQALVAPLQSELKLDPTPIAHRTHGLNP
GNLTKYDARIAAIDYTLAHDDGISLRNLDQAQVILLGVSRCGKTPTSLYLAMQFGIRAAN
YPFIADDMDNLVLPAALKPLQHKLFGLTINPERLAAIREERRENSRYASMRQCRMEVSEV
EALYRKNQIPWLNSTNYSVEEIATKILDIMGLNRRMY