Protein Info for MPMX20_01876 in Enterobacter sp. TBS_079

Annotation: PTS system N,N'-diacetylchitobiose-specific EIIB component

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 105 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details TIGR00853: PTS system, lactose/cellobiose family IIB component" amino acids 1 to 94 (94 residues), 113.4 bits, see alignment E=4.1e-37 PF02302: PTS_IIB" amino acids 6 to 94 (89 residues), 55.2 bits, see alignment E=4.5e-19

Best Hits

Swiss-Prot: 96% identical to PTQB_ECOLI: PTS system N,N'-diacetylchitobiose-specific EIIB component (chbB) from Escherichia coli (strain K12)

KEGG orthology group: K02760, PTS system, cellobiose-specific IIB component [EC: 2.7.1.69] (inferred from 99% identity to enc:ECL_02439)

MetaCyc: 96% identical to N,N'-diacetylchitobiose-specific PTS enzyme IIB component (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-155B [EC: 2.7.1.196]

Predicted SEED Role

"PTS system, N,N'-diacetylchitobiose-specific IIB component (EC 2.7.1.69)" (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.196 or 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (105 amino acids)

>MPMX20_01876 PTS system N,N'-diacetylchitobiose-specific EIIB component (Enterobacter sp. TBS_079)
MEKKHIYLFCSAGMSTSLLVSKMRAQAEKYEVPVVIEAFPETLAGEKGQTADVVLLGPQI
AYMLPEIQRLLPNKPVEVIDSGLYGKIDGLGVLKAAVAAIKKAAN