Protein Info for MPMX20_01763 in Enterobacter sp. TBS_079

Annotation: sugar efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 404 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 51 to 69 (19 residues), see Phobius details amino acids 81 to 99 (19 residues), see Phobius details amino acids 105 to 129 (25 residues), see Phobius details amino acids 138 to 156 (19 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 218 to 240 (23 residues), see Phobius details amino acids 247 to 271 (25 residues), see Phobius details amino acids 281 to 301 (21 residues), see Phobius details amino acids 307 to 328 (22 residues), see Phobius details amino acids 343 to 362 (20 residues), see Phobius details amino acids 368 to 388 (21 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 320 (303 residues), 101.1 bits, see alignment E=3.2e-33

Best Hits

KEGG orthology group: None (inferred from 93% identity to enc:ECL_02554)

Predicted SEED Role

"MFS permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (404 amino acids)

>MPMX20_01763 sugar efflux transporter (Enterobacter sp. TBS_079)
MNTTTAPHAASRWVIFMLALGAGFSVASIYYAQPLLPLIGADLHLSIEGMGLVPTLTQAG
YALGTLFLLPLGDRHDRRTLILIKSTALALFLLGCSLTGQQHSLLLASLLIGMAATMAQD
IVPAAAILAPEGKQGKTVGTVMTGLLMGILLSRTVSGVVGEAFGWRVMYQLAAVSIAFIG
AVMWRVLPRFAIHSTLSYPALMRSMEHLWRRYPALRRAALAQGFLSIAFSAFWSTLAVML
LERYHLGSAVAGGFGIAGAAGALAAPLAGGLADKLGAGKVTQLGAALVTVSFALIFLMPA
LGLHGQLILIAVSAIGFDLGLQSSLVAHQNLVYSLEPQARGRLNALLFTVVFIGMALGSA
AGSKIYTLAGWTGVVALATVCGVIALAIRLIESARVASAPAEIA