Protein Info for MPMX20_01748 in Enterobacter sp. TBS_079

Annotation: putative lipid II flippase MurJ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 511 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 27 to 47 (21 residues), see Phobius details amino acids 83 to 110 (28 residues), see Phobius details amino acids 130 to 152 (23 residues), see Phobius details amino acids 161 to 180 (20 residues), see Phobius details amino acids 186 to 204 (19 residues), see Phobius details amino acids 236 to 259 (24 residues), see Phobius details amino acids 274 to 291 (18 residues), see Phobius details amino acids 311 to 332 (22 residues), see Phobius details amino acids 353 to 373 (21 residues), see Phobius details amino acids 383 to 402 (20 residues), see Phobius details amino acids 408 to 429 (22 residues), see Phobius details amino acids 441 to 465 (25 residues), see Phobius details amino acids 478 to 501 (24 residues), see Phobius details TIGR01695: murein biosynthesis integral membrane protein MurJ" amino acids 2 to 508 (507 residues), 576.8 bits, see alignment E=2.1e-177 PF03023: MurJ" amino acids 28 to 478 (451 residues), 538.1 bits, see alignment E=8e-166

Best Hits

Swiss-Prot: 91% identical to MURJ_SALTY: Probable lipid II flippase MurJ (murJ) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K03980, virulence factor (inferred from 96% identity to enc:ECL_02569)

MetaCyc: 91% identical to lipid II flippase MurJ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-286

Predicted SEED Role

"Proposed peptidoglycan lipid II flippase MurJ" in subsystem ZZ gjo need homes

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (511 amino acids)

>MPMX20_01748 putative lipid II flippase MurJ (Enterobacter sp. TBS_079)
MNLLKSLAAVSSMTMFSRVLGFARDAIVARVFGAGMATDAFFVAFKLPNLLRRIFAEGAF
SQAFVPILAEYKSKQGEDATRVFVAYVSGLLTLALAIVTVLGMLAAPWVIMVTAPGFADT
ADKFALTTQLLRITFPYILLISLASLVGAILNTWNRFSVPAFAPTFLNVSMIGFALFAAP
HFNPPVLALAWAVTVGGVLQLAYQLPHLKKIGMLVLPRINFRDAGAMRVMKQMGPAILGV
SVSQISLIINTIFASFLVSGSVSWMYYADRLMEFPSGVLGVALGTILLPSLSKSFASGNH
DEYCRLMDWGLRLCFLLALPSAVALGILAKPLTVSLFQYGKFSAHDASMTQQALVAYSVG
LMGLIVVKVLAPGFYSRQNIKTPVKIALVTLVMTQLMNLAFIGPLKHAGLALSIGLAACL
NAGLLYWQLRKQDIFTPQPGWASFLVRLVIAVLVMAAALLGMMHVMPEWSLGTMPYRLLR
LMAVVGVGVVAYFATLAVLGFKVKEFARRTA