Protein Info for MPMX20_01709 in Enterobacter sp. TBS_079

Annotation: Protein PhoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF02562: PhoH" amino acids 149 to 353 (205 residues), 260.6 bits, see alignment E=1.3e-81 PF13604: AAA_30" amino acids 153 to 308 (156 residues), 28.3 bits, see alignment E=2.2e-10 PF13245: AAA_19" amino acids 164 to 307 (144 residues), 26 bits, see alignment E=1.3e-09

Best Hits

Swiss-Prot: 85% identical to PHOH_ECO57: Protein PhoH (phoH) from Escherichia coli O157:H7

KEGG orthology group: K06217, phosphate starvation-inducible protein PhoH and related proteins (inferred from 88% identity to ent:Ent638_1548)

Predicted SEED Role

"Phosphate starvation-inducible protein PhoH, predicted ATPase" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>MPMX20_01709 Protein PhoH (Enterobacter sp. TBS_079)
MVASCTGHGKHNTRSTRRGGSDSGSDFLTTKLSPSTQESLSTDVQNGARSRSVASSGKAS
NGLQGSQPSDVRAHNRAETGTCDEYQQLKVLSMGRQKAVIKARREAKRVLRRDSRSHKQR
EEESVTSLVQMSGVEAIGMARDSRDNSPIVARNEAQAHYLNAIESKQLIFATGEAGCGKT
WISAAKAAEALIHKDVERIIVTRPVLQADEDLGFLPGDISEKFAPYFRPVYDVLVKRLGA
SFMQYCLRPEIGKVEIAPFAYMRGRTFENAVVILDEAQNVTAAQMKMFLTRLGENVTVIV
NGDITQCDLPSGVKSGLSDAMSRFEEDEMIGVVRFTKEDCVRSALCQRTLQAYY