Protein Info for MPMX20_01683 in Enterobacter sp. TBS_079

Annotation: Magnesium transporter MgtE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 transmembrane" amino acids 20 to 37 (18 residues), see Phobius details amino acids 169 to 188 (20 residues), see Phobius details amino acids 194 to 221 (28 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details amino acids 269 to 293 (25 residues), see Phobius details amino acids 303 to 325 (23 residues), see Phobius details PF00571: CBS" amino acids 81 to 135 (55 residues), 22.9 bits, see alignment E=8.8e-09 PF01769: MgtE" amino acids 202 to 323 (122 residues), 111.9 bits, see alignment E=2.5e-36

Best Hits

KEGG orthology group: K06213, magnesium transporter (inferred from 94% identity to enc:ECL_02639)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (333 amino acids)

>MPMX20_01683 Magnesium transporter MgtE (Enterobacter sp. TBS_079)
MSYAIHNQNLAFNDSAIAQYMNTDFIVLDISLCVALARVQFFEKLKDDDIPSHIFLEDNG
RLAGMVAVRKLLQTADTVQPVKTLMISQFLQVKPEDERADVAGLLAHGEADVVPVVTHGK
VVGCLTEREIAHLLEDDVTEDAQLQGATLPLEKPYLETSPFSLWKKRSVWLLLLFVAEAY
TSSVIQHFEEALESAIALAFFIPLLIGTGGNSGTQITSTLVRAMALGEVRLRDVGRVLRK
EMTTSLMIAATLGLAGCVRAWMMGIGLEITLIVSLTLVCITLWSAIVSSVIPMVLKRCGI
DPAVVSAPFIATLIDGTGLIIYFKIAQYTLGLE