Protein Info for MPMX20_01647 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 820 TIGR03361: type VI secretion system Vgr family protein" amino acids 26 to 498 (473 residues), 226.2 bits, see alignment E=7e-71 TIGR01646: Rhs element Vgr protein" amino acids 26 to 500 (475 residues), 316.3 bits, see alignment E=4.1e-98 PF05954: Phage_GPD" amino acids 33 to 339 (307 residues), 207.4 bits, see alignment E=6.2e-65 PF04717: Phage_base_V" amino acids 390 to 456 (67 residues), 29.9 bits, see alignment E=1.2e-10 PF13296: T6SS_Vgr" amino acids 476 to 575 (100 residues), 102.5 bits, see alignment E=2.7e-33 PF10106: DUF2345" amino acids 603 to 727 (125 residues), 107.7 bits, see alignment E=9.7e-35

Best Hits

KEGG orthology group: None (inferred from 87% identity to ses:SARI_00371)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (820 amino acids)

>MPMX20_01647 hypothetical protein (Enterobacter sp. TBS_079)
MDNWLALFDGQTRYSLDINNSQVKPDVLRFRGREALSEPFKWDIEFTTQQANIPPEQVLM
KYASFRMRSGKNVHGIITRLEWLSTSKDQSHYRLTLSSRLSLLGYTRQCAVYQNQSVPEV
VEQVLRKHGLEGPDFEFRLERTYPPREIITQWRETDLEFIQRILSEVGIYWRTVMDDVRG
LDTYLLADSQLNYQFDVRLPYSEPSGLFDGAAESVWDVRTWHTLATGTVATRDYNYRTAS
TPMDATVSVRNDAVTTGEHYRYAAPYRDAGDDTSPEPETESGAFWARLHHERELNRTTRI
HLFSNAAHLAPGQVLEPQGDVITALKEGVILTLVTYRGARDSRLHVSVWGMPYTERYCFR
PTEIPRPEIRGTLPARVESQEKNDIYAHLDEQGRYRVKPDFDREGTEQGFGYLWLRMAKP
YAGETLGWHAPLTDGTEVAIAYSNGDIDLPYIAYALHDSEHPDLVNRDNHTRNILRTPAN
SKLRMEDKRGEEHIKLATEYGKTQLNSGHLVDNQGKSRGTGSELRTDEYGSIRAAKGLFA
SADGQPKAQGEALDMDVALKEIDRLNQQLQQLEIAAEKAQALKADVDSQIQMFEQRLKPL
NEAVHFTAPEGMALTSGENMQLAAARNVVVNAGGDISVGTMGNLTALAGEKLGLFARTGQ
LSVKSGEGPIDVQAQNASMRLFAEKKLTLSSVSDILFAGKKRITLIGGGSYLRLEAGKVE
YGTTASYIRKVKRTMAAGSSPQSPELPFLPGPGDAFRRSFILVDDRTQEPISNIGYELTS
SIGKVVKGFSCEKGLTGFISHTEEADIELTILKQNSLYIG