Protein Info for MPMX20_01488 in Enterobacter sp. TBS_079

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 106 PF12840: HTH_20" amino acids 11 to 59 (49 residues), 31.2 bits, see alignment E=1.7e-11 PF01022: HTH_5" amino acids 13 to 59 (47 residues), 58.9 bits, see alignment E=3.5e-20

Best Hits

Swiss-Prot: 66% identical to ARSR_ECOLI: Arsenical resistance operon repressor (arsR) from Escherichia coli (strain K12)

KEGG orthology group: K03892, ArsR family transcriptional regulator (inferred from 92% identity to enc:ECL_02869)

MetaCyc: 66% identical to DNA-binding transcriptional repressor ArsR (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Arsenical resistance operon repressor" in subsystem Arsenic resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (106 amino acids)

>MPMX20_01488 hypothetical protein (Enterobacter sp. TBS_079)
MLHPVQLFKALSDETRLSIVMLLREAGELCVCDLCSATAESQPKVSRHMALLRESGLVSD
RREGKWVYYRLSPTMPAWAATVIDNSWNCLREETRAKLKNRLPGAC