Protein Info for MPMX20_01439 in Enterobacter sp. TBS_079

Annotation: Glutamine transport system permease protein GlnP

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 219 transmembrane" amino acids 22 to 43 (22 residues), see Phobius details amino acids 54 to 78 (25 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 153 to 171 (19 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 12 to 111 (100 residues), 106.5 bits, see alignment E=4.2e-35 PF00528: BPD_transp_1" amino acids 33 to 217 (185 residues), 96.3 bits, see alignment E=9.9e-32

Best Hits

Swiss-Prot: 94% identical to GLNP_ECO57: Glutamine transport system permease protein GlnP (glnP) from Escherichia coli O157:H7

KEGG orthology group: K10037, glutamine transport system permease protein (inferred from 100% identity to enc:ECL_02921)

MetaCyc: 94% identical to L-glutamine ABC transporter membrane subunit (Escherichia coli K-12 substr. MG1655)
ABC-12-RXN [EC: 7.4.2.1]

Predicted SEED Role

"Glutamate transport membrane-spanning protein"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (219 amino acids)

>MPMX20_01439 Glutamine transport system permease protein GlnP (Enterobacter sp. TBS_079)
MQFDWSAIWPAIPILLEGAKMTLWISVLGLVGGLIIGLVAGFARTYGGWIANHIALVFIE
VIRGTPIVVQVMFIYFALPMAFTDLRIDPFSAAVVTIMINSGAYIAEITRGAVLSIHKGF
SEAGLALGLSRRETIRHVILPLALRRMLPPLGNQWIISIKDTSLFIVIGVAELTRQGQEI
IAGNFRALEIWSAVAVVYLIITLVLSFVLRRLERRMKIL