Protein Info for MPMX20_01437 in Enterobacter sp. TBS_079

Annotation: Moderate conductance mechanosensitive channel YbiO

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 736 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 139 to 161 (23 residues), see Phobius details amino acids 181 to 204 (24 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 263 to 285 (23 residues), see Phobius details amino acids 291 to 314 (24 residues), see Phobius details amino acids 334 to 363 (30 residues), see Phobius details amino acids 375 to 397 (23 residues), see Phobius details amino acids 419 to 445 (27 residues), see Phobius details amino acids 465 to 487 (23 residues), see Phobius details amino acids 508 to 529 (22 residues), see Phobius details amino acids 535 to 554 (20 residues), see Phobius details PF25392: MS_channel_TM1" amino acids 375 to 453 (79 residues), 87.8 bits, see alignment E=8e-29 PF21088: MS_channel_1st" amino acids 515 to 555 (41 residues), 41.9 bits, see alignment 1.6e-14 PF00924: MS_channel_2nd" amino acids 556 to 620 (65 residues), 64.7 bits, see alignment E=1.3e-21 PF21082: MS_channel_3rd" amino acids 627 to 712 (86 residues), 37.2 bits, see alignment E=6.4e-13

Best Hits

Swiss-Prot: 82% identical to YBIO_ECOLI: Moderate conductance mechanosensitive channel YbiO (ybiO) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to enc:ECL_02923)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (736 amino acids)

>MPMX20_01437 Moderate conductance mechanosensitive channel YbiO (Enterobacter sp. TBS_079)
MPWILLLLSLFCAPSFAVSIPGVTTGTTATQQTTPPPEPDVEQKKAAYSALADVLENDTS
RQELIGQLRKVAATPPQEPVPTITPPQVEEQKTVLENVTDVSRHYGSELSSRFAQLYRNL
IGSPHKPFNPHTFTTAATQFLMLAGAVFLFYWLVRLCAWPLYRKMGQWGRKKNQQKSSWL
HLPLMIASAFIIDLLLLALTLFMGQVLADRLNAGNKTIAFQQALFLNAFALIEFFKALLR
LIFCPHVPDLRPFSIRDESARYWALRLSVLSGLIGYGLLVAVPIISNQVNVQFGALANVL
IMICITVWALYLIFHNKKTITQSLLHLADRSLSFFSLFIRAFALVWHWLASAYFIVLCFF
SLFDPGNSLKFMMGATFKSLAIIGIAAFVSGLLSRWLSKTFTLSPQVQRSYPELQKRVNG
WISVSLKVARILTVCVAIMLLLNAWGLFDFWNWLHNGAGEKTVDILIRIALILFFSAVGW
TLLASLIENRLVSDIHGRPLPSARARTLLTLFRNALAVIISTITIMIVLSEIGVNIAPLL
AGAGALGLAISFGSQTLVKDIITGVFIQFENGMNTGDLVTIGPLTGTVERMSIRSVGVRQ
DTGAYHIIPWSSITTFANFVRGIGSVVANYDVDRHEDADKAKQALRDAVEEMMAMEDIRG
LVIGEPSFAGIVGLTNTAFTLRVSFTTQPLKQWTVRFALDSMVKKHFDLAAVRMPVQTYQ
VLPSPTSPTPPQEPTL