Protein Info for MPMX20_01409 in Enterobacter sp. TBS_079

Annotation: Putative gluconeogenesis factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 302 PF01933: CofD" amino acids 12 to 260 (249 residues), 265.5 bits, see alignment E=2.7e-83 TIGR01826: conserved hypothetical protein" amino acids 12 to 259 (248 residues), 323.1 bits, see alignment E=1e-100

Best Hits

Swiss-Prot: 85% identical to GNGF_SALTY: Putative gluconeogenesis factor (ybhK) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: None (inferred from 97% identity to enc:ECL_02954)

Predicted SEED Role

"FIG002813: LPPG:FO 2-phospho-L-lactate transferase like, CofD-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (302 amino acids)

>MPMX20_01409 Putative gluconeogenesis factor (Enterobacter sp. TBS_079)
MRNRTFADLDRVVALGGGHGLGRVMSSLSSLGSRLTGIVTTTDNGGSTGRIRRAEGGIAW
GDMRNCLNQLITEPSVASAMFEYRFGGNGELSGHNLGNLMLKALDHLSVRPLEAINLIRN
LLKVDAFLIPMSEQPVDLMAIDAEGHEVYGEVNIDQLTVPPKELMTYPSVPATREAIEAI
GEADLILIGPGSFYTSLMPILLVKELAQALRRTPAPMVYIGNLGRELSPAAASLLLADKL
NLMEQYVGKKIIDGVVVGPKVDVSGIGDRVVVQEPLEASDIKYRHDRHLLREALEKAIQD
LG