Protein Info for MPMX20_01280 in Enterobacter sp. TBS_079

Annotation: Putative cryptic C4-dicarboxylate transporter DcuD

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 6 to 22 (17 residues), see Phobius details amino acids 29 to 50 (22 residues), see Phobius details amino acids 79 to 98 (20 residues), see Phobius details amino acids 117 to 149 (33 residues), see Phobius details amino acids 156 to 179 (24 residues), see Phobius details amino acids 195 to 218 (24 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details amino acids 307 to 332 (26 residues), see Phobius details amino acids 336 to 363 (28 residues), see Phobius details amino acids 403 to 421 (19 residues), see Phobius details amino acids 433 to 452 (20 residues), see Phobius details PF03606: DcuC" amino acids 6 to 451 (446 residues), 488 bits, see alignment E=2.4e-150 TIGR00771: transporter, anaerobic C4-dicarboxylate uptake C (DcuC) family" amino acids 58 to 441 (384 residues), 627 bits, see alignment E=7.4e-193 PF06808: DctM" amino acids 147 to 449 (303 residues), 33.5 bits, see alignment E=2.2e-12

Best Hits

Swiss-Prot: 92% identical to DCUC_ECOL6: Anaerobic C4-dicarboxylate transporter DcuC (dcuC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03326, C4-dicarboxylate transporter, DcuC family (inferred from 96% identity to enc:ECL_03074)

MetaCyc: 92% identical to anaerobic C4-dicarboxylate transporter DcuC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-106; TRANS-RXN-299; TRANS-RXN-300

Predicted SEED Role

"C4-dicarboxylate transporter DcuC (TC 2.A.61.1.1)" (TC 2.A.61.1.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (455 amino acids)

>MPMX20_01280 Putative cryptic C4-dicarboxylate transporter DcuD (Enterobacter sp. TBS_079)
MLTFIELLIGVVVIVGVARYIIKGYSATGVLFVGGLTLLIISAIMGHQVLPASADSTGYT
ATDIVEYIKILLMSRGGDLGMMIMMLCGFAAYMTHIGANDMVVKLASKPLQYINSPYLLM
VAAYFLACLMSLAVSSATGLGVLLMATLFPIMVNVGISRGAAAAICASPAAIILSPTSGD
VVLAAKAAEMSLIDFAFKTTLPISIVAIVGMGIAHFFWQRYLDKKENISHEMLDVSEITT
TAPAFYAILPFTPIIGVLIFDGKWGPQLHIITILVICMLLAALLEFVRGFNTQKVFSGLE
VAYRGMADAFAGVVMLLVAAGVFAQGLSTIGFIQSLISIATSFGSASIILMLVLVVLTML
AAMTTGSGNAPFYAFVEMIPKLAHSSGINPAYLSIPMLQASNLGRTISPVSGVVVAVAGM
AKISPFEVIKRTSVPVIVGLIIVIIATQVLVPGAA