Protein Info for MPMX20_01264 in Enterobacter sp. TBS_079

Annotation: Methylthioribose-1-phosphate isomerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00512: S-methyl-5-thioribose-1-phosphate isomerase
  • amino acids 8 to 328 (321 residues), 403 bits, E=9.2e-125
• TIGR00524: eIF-2B alpha/beta/delta-related uncharacterized proteins
  • amino acids 35 to 329 (295 residues), 308.2 bits, E=5.6e-96
• PF01008: IF-2B
  • amino acids 48 to 329 (282 residues), 241.9 bits, E=4.2e-76

Best Hits

Swiss-Prot: 91% identical to MTNA_CITK8: Methylthioribose-1-phosphate isomerase (mtnA) from Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696)

KEGG orthology group: K08963, methylthioribose-1-phosphate isomerase [EC: 5.3.1.23] (inferred from 94% identity to enc:ECL_03090)

MetaCyc: 83% identical to 5-methylthioribose-1-phosphate isomerase monomer (Klebsiella pneumoniae)
S-methyl-5-thioribose-1-phosphate isomerase. [EC: 5.3.1.23]

Predicted SEED Role

"Methylthioribose-1-phosphate isomerase (EC 5.3.1.23)" in subsystem Methionine Salvage (EC 5.3.1.23)

MetaCyc Pathways

• L-methionine salvage cycle I (bacteria and plants) (11/12 steps found)
• L-methionine salvage cycle III (10/11 steps found)
• L-methionine salvage cycle II (plants) (9/11 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation I (6/7 steps found)
• 5'-deoxyadenosine degradation II (3/4 steps found)
• 5'-deoxyadenosine degradation I (2/3 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation II (1/5 steps found)
• S-methyl-5-thio-α-D-ribose 1-phosphate degradation III (1/5 steps found)

KEGG Metabolic Maps

• Methionine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.3.1.23

Protein Sequence (338 amino acids)

>MPMX20_01264 Methylthioribose-1-phosphate isomerase (Enterobacter sp. TBS_079)
MQTLQTTSLRVAENQLFILDQQALPQEKRWLDASTVEALVGHIHALRVRGAPLIGLSASL
LLALLAENGKSRDELAVALETLRASRPTAVNLMNNLDRMKLALWQEDFVPALAAEALRLI
DEDKQLCEAIANAGSTLVKPGSRLLTHCNTGGLATAGVGTALGVIARAHQEGRVSTVWVD
ETRPLLQGGRLTAWELGELGVPYQLIADSMAASLMAKGLVDAVWVGADRIAANGDVANKI
GTYSLAVLATFHGIPFYVAAPHTTLDPACPNGEAIPIEQRAASEVTGVAGSFGAVQWAPE
NAQVYNPAFDVTPAALISGWVLDTGIVTPEEVAKGKFA