Protein Info for MPMX20_01246 in Enterobacter sp. TBS_079

Annotation: Ferrienterobactin-binding periplasmic protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 319 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details PF01497: Peripla_BP_2" amino acids 49 to 297 (249 residues), 71.6 bits, see alignment E=3.5e-24

Best Hits

Swiss-Prot: 81% identical to FEPB_ECOL6: Ferrienterobactin-binding periplasmic protein (fepB) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K02016, iron complex transport system substrate-binding protein (inferred from 93% identity to enc:ECL_03109)

MetaCyc: 81% identical to ferric enterobactin ABC transporter periplasmic binding protein (Escherichia coli K-12 substr. MG1655)
ABC-10-RXN [EC: 7.2.2.17]

Predicted SEED Role

"Ferric enterobactin-binding periplasmic protein FepB (TC 3.A.1.14.2)" in subsystem Siderophore Enterobactin (TC 3.A.1.14.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.2.2.17

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (319 amino acids)

>MPMX20_01246 Ferrienterobactin-binding periplasmic protein (Enterobacter sp. TBS_079)
MKCLAVCRNPLLFIGLFVLGLTSALAADWPRQVTDSRGVHTLEHKPTRIVSTSVTLTGSL
LAIDAPVIASGATTPNNRVADAQGFLRQWGDIAKQRQLARLYIGEPSAEAVAAQMPDLIL
ISATGGDSALALYDQLSAIAPTLVINYDDKSWQALLKQLGTITGQEKQAAERIAAFDKQL
AQVKQQMTLPPQPVNAIVYTAAAHSANLWTAESAQGQLLQQLGFTLAELPAGLHTSKSQG
QRHDIIQLGGENLATGLNGEGLFLFAGDQKDVDAIYANPLLAHLPAVQNKRVWALGTETF
RLDYYSAMRVLQRLDAQFR